Caspase-3 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A2156
Zusätzliche Namen:: -3|CPP32|CPP32B|SCA-1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 32kDa,17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
Uniprot:: P42574
Synonyme:: apopain;CASP-3;caspase 3, apoptosis-related cysteine peptidase;caspase 3, apoptosis-related cysteine protease;caspase-3;CPP-32;CPP32;CPP32B;cysteine protease CPP32;PARP cleavage protease;procaspase3;protein Yama;SCA-1;SREBP cleavage activity 1
Weitere Details:: The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.