A21543
PIK3C2A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A21543
- Zusätzliche Namen:
- CPK|OCSKD|PI3-K-C2(ALPHA)|PI3-K-C2A|PI3K-C2-alpha|PI3K-C2alpha|PIK3C2A
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPL
- Uniprot:
- O00443
- Synonyme:
- C2-containing phosphatidylinositol kinase;CPK;OCSKD;phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha;phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha;phosphoinositide 3-kinase-C2-alpha;phosphoinositide-3-kinase, class 2, alpha polypeptide;PI3-K-C2(ALPHA);PI3-K-C2A;PI3K-C2-alpha;PI3K-C2alpha;ptdIns-3-kinase C2 subunit alpha
- Weitere Details:
- The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling.
- Versandbedingungen:
- Blue Ice








