[KO Validated] TDP2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21536
Zusätzliche Namen:: AD022|dJ30M3.3|EAP2|EAPII|hTDP2|P2|TTRAP
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP
Uniprot:: O95551
Synonyme:: 5'-Tyr-DNA phosphodiesterase;5'-tyrosyl-DNA phosphodiesterase;AD022;dJ30M3.3;EAP2;EAPII;epididymis secretory sperm binding protein;ETS1-associated protein 2;ETS1-associated protein II;hTDP2;TRAF and TNF receptor-associated protein;TTRAP;tyr-DNA phosphodiesterase 2;tyrosyl-DNA phosphodiesterase 2;tyrosyl-RNA phosphodiesterase;VPg unlinkase
Weitere Details:: This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.

Versandbedingungen:: Blue Ice