A2152
KBTBD3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2152
- Zusätzliche Namen:
- 2200003A07Rik|Bklhd3|KBTBD3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 69kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSEVEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWYSNHF
- Synonyme:
- 2200003A07Rik;Bklhd;Bklhd3;BTB and kelch domain containing 3;BTB and kelch domain-containing protein 3;epididymis secretory sperm binding protein;kelch repeat and BTB (POZ) domain containing 3;kelch repeat and BTB domain-containing protein 3
- Weitere Details:
- Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and tooth. Orthologous to human KBTBD3 (kelch repeat and BTB domain containing 3).
- Versandbedingungen:
- Blue Ice