A21519
OCRL Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A21519
- Zusätzliche Namen:
- Dent-2|DENT2|INPP5F|LOCR|NPHL2|OCRL|OCRL-1|OCRL1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQRE
- Uniprot:
- Q01968
- Synonyme:
- Dent-2;DENT2;inositol polyphosphate 5-phosphatase OCRL;inositol polyphosphate 5-phosphatase OCRL-1;INPP5F;LOCR;Lowe oculocerebrorenal syndrome protein;NPHL2;OCRL-1;OCRL1;oculocerebrorenal syndrome of Lowe;phosphatidylinositol 3,4,5-triphosphate 5-phosphatase;phosphatidylinositol polyphosphate 5-phosphatase
- Weitere Details:
- This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

