A2149
EPPIN Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2149
- Zusätzliche Namen:
- CT71|CT72|dJ461P17.2|EPPIN|SPINLW1|WAP7|WFDC7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
- Uniprot:
- O95925
- Synonyme:
- cancer/testis antigen 71;cancer/testis antigen 72;CT71;CT72;dJ461P17.2;epididymal protease inhibitor;epididymis secretory sperm binding protein;eppin;protease inhibitor WAP7;serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin);Serine protease inhibitor-like with Kunitz and WAP domains 1;SPINLW1;SPINLW1-WFDC6;SPINLW1-WFDC6 fusion protein;SPINLW1-WFDC6 read-through transcript;SPINLW1-WFDC6 readthrough;WAP four-disulfide core domain protein 7;WAP7;WFDC7
- Weitere Details:
- This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. The protein can inhibit human sperm motility and exhibits antimicrobial activity against E. coli, and polymorphisms in this gene are associated with male infertility. Read-through transcription also exists between this gene and the downstream WFDC6 (WAP four-disulfide core domain 6) gene. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

