[KO Validated] GSTK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21473
Zusätzliche Namen:: GST|GST 13-13|GST13|GST13-13|GSTK1|GSTK1-1|hGSTK1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Uniprot:: Q9Y2Q3
Synonyme:: glutathione S-transferase k1;glutathione S-transferase kappa 1;Glutathione S-transferase subunit 13;glutathione S-transferase subunit 13 homolog;GST;GST 13-13;GST class-kappa;GST13;GST13-13;GSTK1-1;hGSTK1
Weitere Details:: This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.