LETMD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2147
Zusätzliche Namen:: 1110019O13Rik|HCCR|HCCR-1|HCCR-2|HCCR1|HCCR2|HCRR-2|LETMD1|SLC55A3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYLGTRR
Uniprot:: Q6P1Q0
Synonyme:: 1110019O13Rik;cervical cancer 1 proto-oncogene protein p40;cervical cancer proto-oncogene 2 protein;epididymis secretory sperm binding protein;HCCR;HCCR-1;HCCR-2;HCCR1;HCCR2;HCRR-2;human cervical cancer oncogene;LETM1 domain-containing protein 1;regulator of TP53;SLC55A3
Weitere Details:: This gene encodes a mitochondrial outer membrane protein. It has a potential role in tumorigenesis, which may result from negative regulation of the p53 tumor suppressor gene. Alternatively spliced transcript variants have been noted for this gene.