Placental alkaline phosphatase (PLAP) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21424
Zusätzliche Namen:: ALP|ALPI|IAP|PALP|Placental alkaline phosphatase (PLAP)|PLAP|PLAP-1
Anwendung:: ELISA, WB, IP
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
Uniprot:: P05187
Synonyme:: alkaline phosphatase Regan isozyme;alkaline phosphatase, placental type;alkaline phosphomonoesterase;ALP;ALPI;glycerophosphatase;IAP;Intestinal alkaline phosphatase;Intestinal-type alkaline phosphatase;PALP;placental alkaline phosphatase 1;PLAP;PLAP-1
Weitere Details:: The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.

Versandbedingungen:: Blue Ice