[KO Validated] ATG4A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21356
Zusätzliche Namen:: APG4A|ATG4A|AUTL2|HsAPG4A
Anwendung:: ELISA, WB
Molekulargewicht:: 45kDa/50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Uniprot:: Q8WYN0
Synonyme:: APG4 autophagy 4 homolog A;APG4A;ATG4 autophagy related 4 homolog A;AUT-like 2 cysteine endopeptidase;AUT-like 2, cysteine endopeptidase;AUTL2;autophagin 2;Autophagin-2;autophagy-related cysteine endopeptidase 2;autophagy-related protein 4 homolog A;cysteine protease ATG4A;hAPG4A
Weitere Details:: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.

Versandbedingungen:: Blue Ice