PSIP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21350
Zusätzliche Namen:: DFS70|LEDGF|p52|p75|PAIP|PSIP1|PSIP2
Anwendung:: ELISA, WB
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN
Uniprot:: O75475
Synonyme:: CLL-associated antigen KW-7;dense fine speckles 70 kDa protein;DFS70;LEDGF;lens epithelium-derived growth factor;p52;p75;PAIP;PC4 and SFRS1-interacting protein;PSIP2;transcriptional coactivator p52/p75;Transcriptional coactivator p75/p52
Weitere Details:: Enables DNA-binding transcription factor binding activity; chromatin binding activity; and transcription coactivator activity. Involved in mRNA 5'-splice site recognition and positive regulation of transcription by RNA polymerase II. Located in heterochromatin; nuclear periphery; and nucleoplasm.