[KO Validated] IRF9 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21331
Zusätzliche Namen:: F9|IRF-9|ISGF3|ISGF3G|p48
Anwendung:: ELISA, WB
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSME
Uniprot:: Q00978
Synonyme:: IFN-alpha-responsive transcription factor subunit;interferon regulatory factor 9;interferon-stimulated gene factor 3 gamma;interferon-stimulated transcription factor 3, gamma (48kD);interferon-stimulated transcription factor 3, gamma 48kDa;IRF-9;ISGF-3 gamma;ISGF3;ISGF3 p48 subunit;ISGF3G;p48;transcriptional regulator ISGF3 subunit gamma
Weitere Details:: This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65.