TIFY11B Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21305
Zusätzliche Namen:: jasmonate-zim-domain protein 6|T10D10_8|T10D10.8|TIFY DOMAIN PROTEIN 11B|TIFY11B
Anwendung:: ELISA, WB
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Plant
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Plant
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: NNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL
Uniprot:: Q9C9E3
Synonyme:: AT1G72450;Jasmonate ZIM domain-containing protein 6;jasmonate-zim-domain protein 6;T10D10_8;T10D10.8;TIFY DOMAIN PROTEIN 11B;TIFY11B
Weitere Details:: JAZ6 transcript levels rise in response to a jasmonate stimulus and a GFP:JAZ6 fusion protein localizes to the nucleus. Application of jasmonate methyl ester to Arabidopsis roots reduces the levels of a JAZ6:GUS fusion protein, presumably by stimulating ubiquitin-proteasome-mediated degradation.