CD117 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21301
Zusätzliche Namen:: Bs|c-KIT|CD117|Fdc|Gsfsco1|Gsfsco5|Gsfsow3|SCO1|SCO5|SOW3|Ssm|Tr-kit|W
Anwendung:: ELISA, WB
Molekulargewicht:: 145KD
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
Uniprot:: P05532
Synonyme:: belly;belly-spot;Bs;c-KI;c-KIT;c-kit proto-oncogene protein;CD117;dominant spotting;Dominant white spotting;Fdc;Gsfs;Gsfsco1;Gsfsco5;Gsfsow3;kit oncogene;mast/stem cell growth factor receptor Kit;proto-oncogene c-Kit;proto-oncogene tyrosine-protein kinase Kit;SC;SCFR;SCO1;SCO5;SO;SOW3;spotted sterile male;Ssm;Steel Factor Receptor;Tr-k;Tr-kit;tyrosine-protein kinase Kit;W
Weitere Details:: The c-Kit proto-oncogene is the cellular homolog of the transforming gene of a feline retrovirus (v-Kit). The c-kit protein includes characteristics of a protein kinase transmembrane receptor. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice