A21292
CMTM6 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A21292
- Zusätzliche Namen:
- CKLFSF6|CMTM6|PRO2219
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20-22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA
- Uniprot:
- Q9NX76
- Synonyme:
- chemokine-like factor super family 6;chemokine-like factor superfamily 6;chemokine-like factor superfamily member 6;CKLF-like MARVEL transmembrane domain-containing protein 6;CKLFSF6;PRO2219
- Weitere Details:
- This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
- Versandbedingungen:
- Blue Ice



