COR28 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21278
Zusätzliche Namen:: COR28|F17I5_170|F17I5.170
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Plant
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Plant
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SKLDECTAWTNEKHNSYLDYLESSFVRQLYSLLGGGTQRLSRTRDVQSNSHKSADQFTVLQNGCWQKVNFGKKQSCLETSSEFRFHRNSLRNKPENSNGNYTMGTTVQGDVLCHDETKHSE
Uniprot:: Q8L983
Synonyme:: AT4G33980;F17I5_170;F17I5.170;uncharacterized protein
Weitere Details:: Light and temperature are two key environmental signals that profoundly affect plant growth and development, COR28 and COR27 are negative regulators of freezing tolerance but positive regulators of flowering. They are involved in central circadian clock regulation and in flowering promotion, by binding to the chromatin of clock-associated evening genes TOC1, PRR5, ELF4 and cold-responsive genes in order to repress their transcription. And also are direct targets of CCA1, which represses their transcription via chromatin binding.