RAV1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21275
Zusätzliche Namen:: AtRAV1|EDF4|ETHYLENE RESPONSE DNA BINDING FACTOR 4|RAV1|related to ABI3/VP1 1|T6J4_2|T6J4.2
Anwendung:: ELISA, WB
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Plant
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Plant
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGSDLDAGRVLRLFGVNISPESSRNDVVGNKRVNDTEMLSLVCSKKQRIFHAS
Uniprot:: Q9ZWM9
Synonyme:: AT1G13260;AtRAV1;EDF4;ETHYLENE RESPONSE DNA BINDING FACTOR 4;Ethylene-responsive transcription factor RAV1;Protein RELATED TO ABI3/VP1 1;related to ABI3/VP1 1;T6J4_2;T6J4.2;uncharacterized protein
Weitere Details:: Encodes an AP2/B3 domain transcription factor which is upregulated in response to low temperature. It contains a B3 DNA binding domain. It has circadian regulation and may function as a negative growth regulator.