LIN28A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21261
Zusätzliche Namen:: CSDD1|LIN-28|lin-28A|LIN28|LIN28A|ZCCHC1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 28 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Uniprot:: Q9H9Z2
Synonyme:: CSDD1;LIN-28;lin-28A;LIN28;protein lin-28 homolog A;RNA-binding protein LIN-28;ZCCHC1;zinc finger CCHC domain-containing protein 1;zinc finger, CCHC domain containing 1
Weitere Details:: This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.