A21240
COX7A1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A21240
- Zusätzliche Namen:
- COX7A|COX7A1|COX7AH|COX7AM
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 9kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
- Uniprot:
- P24310
- Synonyme:
- COX7A;COX7AH;COX7AM;cytochrome c oxidase subunit 7A1, mitochondrial;cytochrome c oxidase subunit VIIa polypeptide 1 (muscle);cytochrome c oxidase subunit VIIa-H;cytochrome c oxidase subunit VIIa-heart;cytochrome c oxidase subunit VIIa-M;cytochrome c oxidase subunit VIIa-muscle
- Weitere Details:
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.
- Versandbedingungen:
- Blue Ice








