A2124
TGF beta 1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2124
- Zusätzliche Namen:
- CED|DPD1|IBDIMDE|LAP|TGF beta 1|TGF-beta1|TGFB|TGFbeta
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 12kDa/25kDa/45-60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
- Uniprot:
- P01137
- Synonyme:
- CED;DPD1;IBDIMDE;LAP;latency-associated peptide;prepro-transforming growth factor beta-1;TGF-beta-1;TGF-beta1;TGFB;TGFbeta;transforming growth factor beta-1 proprotein;transforming growth factor beta1
- Weitere Details:
- This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.
- Versandbedingungen:
- Blue Ice







