TGF beta 1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2124
Zusätzliche Namen:: CED|DPD1|IBDIMDE|LAP|TGF beta 1|TGF-beta1|TGFB|TGFbeta
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 12kDa/25kDa/45-60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Uniprot:: P01137
Synonyme:: CED;DPD1;IBDIMDE;LAP;latency-associated peptide;prepro-transforming growth factor beta-1;TGF-beta-1;TGF-beta1;TGFB;TGFbeta;transforming growth factor beta-1 proprotein;transforming growth factor beta1
Weitere Details:: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.

Versandbedingungen:: Blue Ice