A21224
CD79B Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A21224
- Zusätzliche Namen:
- AGM6|B29|CD79B|IGB|Igbeta
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 30-50kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
- Uniprot:
- P40259
- Synonyme:
- AGM6;B-cell antigen receptor complex-associated protein beta chain;B-cell-specific glycoprotein B29;B29;CD79b antigen (immunoglobulin-associated beta);CD79b molecule, immunoglobulin-associated beta;Ig-beta;IGB;immunoglobulin-associated B29 protein
- Weitere Details:
- The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice