[KO Validated] YAP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21216
Zusätzliche Namen:: COB1|P1|YAP|YAP-1|YAP2|YAP65|YKI
Anwendung:: ChIP, ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Uniprot:: P46937
Synonyme:: 65 kDa Yes-associated protein;COB1;protein yorkie homolog;transcriptional coactivator YAP1;YAP;YAP2;YAP65;Yes associated protein 1;yes-associated protein 2;yes-associated protein YAP65 homolog;YKI;yorkie homolog
Weitere Details:: This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Versandbedingungen:: Blue Ice