A2121
AURKA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2121
- Zusätzliche Namen:
- AIK|ARK1|AURA|AURKA|BTAK|PPP1R47|STK15|STK6|STK7
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
- Uniprot:
- O14965
- Synonyme:
- AIK;ARK1;AURA;aurora 2;aurora kinase A;aurora/IPL1-like kinase;aurora/IPL1-related kinase 1;breast tumor-amplified kinase;BTAK;PPP1R47;protein phosphatase 1, regulatory subunit 47;serine/threonine protein kinase 15;Serine/threonine-protein kinase 15;serine/threonine-protein kinase 6;serine/threonine-protein kinase aurora-A;STK15;STK6;STK7
- Weitere Details:
- The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice



