TAOK1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21157
Zusätzliche Namen:: DDIB|hKFC-B|hTAOK1|KFC-B|MAP3K16|MARKK|PSK-2|PSK2|TAO1|TAOK1
Anwendung:: ELISA, WB
Molekulargewicht:: 116kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS
Uniprot:: Q7L7X3
Synonyme:: hKFC-B;hTAOK1;KFC-B;kinase from chicken homolog B;MAP3K16;MARK Kinase;MARKK;microtubule affinity regulating kinase kinase;prostate-derived STE20-like kinase 2;prostate-derived sterile 20-like kinase 2;PSK-2;PSK2;serine/threonine protein kinase TAO1 homolog;serine/threonine-protein kinase TAO1;STE20-like kinase PSK2;TAO1;thousand and one amino acid protein 1;thousand and one amino acid protein kinase 1
Weitere Details:: Enables alpha-tubulin binding activity; beta-tubulin binding activity; and kinase activity. Involved in several processes, including mitotic G2 DNA damage checkpoint signaling; negative regulation of microtubule depolymerization; and positive regulation of JNK cascade. Located in microtubule cytoskeleton and perinuclear region of cytoplasm.