A21152
NSDHL Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A21152
- Zusätzliche Namen:
- H105E3|NSDHL|SDR31E1|XAP104
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQKLILTSSASVIF
- Uniprot:
- Q15738
- Synonyme:
- epididymis secretory sperm binding protein;H105E3;NAD(P) dependent steroid dehydrogenase-like protein transcript;protein H105e3;SDR31E1;short chain dehydrogenase/reductase family 31E, member 1;sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating;XAP104
- Weitere Details:
- The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene.
- Versandbedingungen:
- Blue Ice