CLIC4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21149
Zusätzliche Namen:: CLIC4|CLIC4L|H1|huH1|MTCLIC|p64H1
Anwendung:: ELISA, WB
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC
Uniprot:: Q9Y696
Synonyme:: chloride intracellular channel 4 like;chloride intracellular channel protein 4;CLIC4L;epididymis secretory sperm binding protein;H1;huH1;intracellular chloride ion channel protein p64H1;MTCLIC;p64H1
Weitere Details:: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).