CD147 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21147
Zusätzliche Namen:: CD147|EMMPRIN|HT-7
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 38-58kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGT
Uniprot:: P18572
Synonyme:: 5A11/Basigin;5F7;AI115436;AI325119;basic immunoglobulin superfamily;basigin;CD147;collagenase stimulatory factor;EMM;EMMPRIN;EMPRIN;extracellular matrix metalloproteinase inducer;gp 42;HAb18G;hepatoma-associated antigen;HT-7;HT7 antigen;leukocyte activation antigen M6;membrane glycoprotein gp42;neuro;neurothelin;OK;OK blood group antigen;SLC7A11;TCSF;tumor cell-derived collagenase stimulatory factor
Weitere Details:: Predicted to enable cell-cell adhesion mediator activity; signaling receptor activity; and virus receptor activity. Involved in neural retina development; photoreceptor cell maintenance; and spermatogenesis. Located in several cellular components, including acrosomal membrane; photoreceptor inner segment; and photoreceptor outer segment. Is expressed in several structures, including alimentary system; brain; early conceptus; reproductive system; and sensory organ. Orthologous to human BSG (basigin (Ok blood group)).

Versandbedingungen:: Blue Ice