A21140
ACTR1B Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A21140
- Zusätzliche Namen:
- ACTR1B|ARP1B|CTRN2|PC3
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
- Uniprot:
- P42025
- Synonyme:
- Actin-related protein 1B;ARP1 actin related protein 1 homolog B;ARP1 actin-related protein 1 homolog B, centractin beta;ARP1B;beta-centractin;centractin beta;CTRN2;PC3
- Weitere Details:
- This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.
- Versandbedingungen:
- Blue Ice








