FAM50A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21133
Zusätzliche Namen:: DXS9928E|FAM50A|HXC-26|HXC26|MRXSA|XAP5
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMK
Uniprot:: Q14320
Synonyme:: 9F;DXS9928E;HXC-26;HXC26;MRXSA;protein FAM50A;Protein HXC-26;protein XAP-5;XAP5
Weitere Details:: This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor.