A21131
NMI Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A21131
- Zusätzliche Namen:
- NMI
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NMI (NP_004679.2).
- Formulierung:
- Unmodified
- Sequenz:
- MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI
- Uniprot:
- Q13287
- Synonyme:
- N-myc and STAT interactor;N-myc-interactor
- Weitere Details:
- NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias.
- Versandbedingungen:
- Blue Ice