SLC25A12 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21129
Zusätzliche Namen:: AGC1|ARALAR|DEE39|EIEE39|SLC25A12
Anwendung:: ELISA, WB, IHC-P, IF, IP
Molekulargewicht:: 70 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant fusion protein containing a sequence corresponding to amino acids 600-678 of human SLC25A12 (NP_003696.2).
Formulierung:: Unmodified
Sequenz:: LLQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ
Uniprot:: O75746
Synonyme:: AGC1;araceli hiperlarga;ARALAR;calcium binding mitochondrial carrier superfamily member Aralar1;calcium-binding mitochondrial carrier protein Aralar1;DEE39;EIEE39;mitochondrial aspartate glutamate carrier 1;solute carrier family 25 (aspartate/glutamate carrier), member 12;solute carrier family 25 (mitochondrial carrier, Aralar), member 12;Solute carrier family 25 member 12
Weitere Details:: This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in this gene may be associated with autism, and mutations in this gene may also be a cause of global cerebral hypomyelination. Alternatively spliced transcript variants have been observed for this gene.