CSDE1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21127
Zusätzliche Namen:: CSDE1|D1S155E|UNR
Anwendung:: ELISA, WB
Molekulargewicht:: 89kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERM
Uniprot:: O75534
Synonyme:: cold shock domain containing E1, RNA binding;cold shock domain-containing protein E1;D1S155E;N-ras upstream gene protein;NRAS-related;Protein UNR;UNR;upstream of NRAS
Weitere Details:: Enables RNA stem-loop binding activity. Involved in IRES-dependent viral translational initiation; nuclear-transcribed mRNA catabolic process, no-go decay; and stress granule assembly. Located in Golgi apparatus; cytosol; and plasma membrane. Part of CRD-mediated mRNA stability complex.