A21108
BIN1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A21108
- Zusätzliche Namen:
- AMPH2|AMPHL|BIN1|CNM2|SH3P9
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 45-80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
- Uniprot:
- O00499
- Synonyme:
- AMPH2;amphiphysin II;amphiphysin-like protein;AMPHL;box dependant MYC interacting protein 1;box-dependent myc-interacting protein 1;Bridging integrator 1;CNM2;myc box-dependent-interacting protein 1;SH3P9
- Weitere Details:
- This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in several transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described.
- Versandbedingungen:
- Blue Ice