Clusterin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21104
Zusätzliche Namen:: AAG4|APO-J|APOJ|CLI|CLU1|CLU2|Clusterin|KUB1|NA1/NA2|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 35-42kDa,65kDa,75kDa/35-42kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Uniprot:: P10909
Synonyme:: AAG4;Aging-associated gene 4 protein;aging-associated protein 4;APO-J;APOJ;apolipoprotein J;CLI;CLU1;CLU2;clusterin;complement cytolysis inhibitor;complement lysis inhibitor;complement-associated protein SP-40,40;epididymis secretory sperm binding protein;ku70-binding protein 1;KUB1;NA1/NA2;SGP-2;SGP2;SP-40;sulfated glycoprotein 2;testosterone-repressed prostate message 2;TRPM-2;TRPM2
Weitere Details:: The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.