A21091
NUCKS1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A21091
- Zusätzliche Namen:
- JC7|NUCKS|NUCKS1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE
- Uniprot:
- Q9H1E3
- Synonyme:
- JC7;NUCKS;nuclear ubiquitous casein and cyclin-dependent kinase substrate 1;nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate;P1;potential LAG1 interactor
- Weitere Details:
- This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle.
- Versandbedingungen:
- Blue Ice