PAK1/PAK2/PAK3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21090
Zusätzliche Namen:: PAK1/PAK2/PAK3|PAKalpha
Anwendung:: ELISA, WB
Molekulargewicht:: 61kDa, 66-68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL
Uniprot:: O75914, Q13153, Q13177
Synonyme:: adriamycin resistance-associated;alpha-PAK;ARA;beta-PAK;bPAK;gamma-PAK;IDDMSSD;MRX30;MRX47;oligophrenin-3;OPHN3;p21 (CDKN1A)-activated kinase 2;p21 (CDKN1A)-activated kinase 3;p21 protein (Cdc42/Rac)-activated kinase 1;p21 protein (Cdc42/Rac)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 3;p21-activated kinase 1;p21-activated kinase 2;p21-activated kinase 3;p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast);p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related);p58;p65-PAK;PAK-2;PAK-3;PAK3beta;PAK65;PAKalpha;PAKgamma;S6/H4 kinase;serine/threonine-protein kinase PAK 1;serine/threonine-protein kinase PAK 2;serine/threonine-protein kinase PAK 3;STE20 homolog, yeast;XLID30
Weitere Details:: This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Versandbedingungen:: Blue Ice