NEK7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21088
Anwendung:: ELISA, WB
Molekulargewicht:: 32kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS
Uniprot:: Q8TDX7
Synonyme:: never in mitosis A-related kinase 7;NIMA (never in mitosis gene a)-related kinase 7;nimA-related protein kinase 7;serine/threonine-protein kinase Nek7
Weitere Details:: NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.