CD32A + CD32B + CD32C Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21073
Zusätzliche Namen:: CD32|CD32A|CD32A + CD32B + CD32C|CDw32|FCG2|FcgammaRIIa|FcGR|FCGR2|FCGR2A1|IGFR2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 25-50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSG
Uniprot:: P12318, P31994, P31995
Synonyme:: CD32;CD32A;CD32B;CD32C;CDw32;Fc fragment of IgG, low affinity II, receptor for (CD32);Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor for (CD32);Fc fragment of IgG, low affinity IIc, receptor for (CD32);Fc gamma receptor IIb;Fc gamma receptor IIC;Fc gamma receptor RIIa3;Fc gamma RIIb;Fc-gamma RII-a;fc-gamma RII-b;Fc-gamma RII-c;fc-gamma-RIIa;fc-gamma-RIIb;Fc-gamma-RIIc;FCG2;FcGR;FCGR2;FCGR2A1;FCGR2C;fcRII-a;fcRII-b;FcRII-c;FCRIIC;IGFR2;igG Fc receptor II-a;igG Fc receptor II-b;IgG Fc receptor II-c;Immunoglobulin G Fc receptor II;immunoglobulin G Fc receptor II-c;low affinity immunoglobulin gamma Fc region receptor II-a;low affinity immunoglobulin gamma Fc region receptor II-b;Low affinity immunoglobulin gamma Fc region receptor II-c
Weitere Details:: This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice