Semaphorin 4D / CD100 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21070
Zusätzliche Namen:: A8|BB18|C9orf164|CD100|coll-4|COLL4|GR3|M-sema-G|SEMAJ|Semaphorin 4D / CD100
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTE
Uniprot:: Q92854
Synonyme:: A8;BB18;C9orf164;CD100;coll-4;COLL4;GR3;M-sema-G;sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D;sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, 4D;SEMAJ;semaphorin-4D
Weitere Details:: Enables identical protein binding activity; semaphorin receptor binding activity; and transmembrane signaling receptor activity. Involved in several processes, including positive regulation of phosphatidylinositol 3-kinase signaling; regulation of neuron projection development; and regulation of phosphate metabolic process. Is integral component of plasma membrane.