A21065
BMP4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A21065
- Zusätzliche Namen:
- BMP2B|BMP2B1|BMP4|MCOPS6|OFC11|ZYME
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN
- Uniprot:
- P12644
- Synonyme:
- BMP2B;BMP2B1;bone morphogenetic protein 2B;bone morphogenetic protein 4;MCOPS6;OFC11;ZYME
- Weitere Details:
- This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
- Versandbedingungen:
- Blue Ice



