CD31/PECAM1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2104
Zusätzliche Namen:: CD31|CD31/EndoCAM|CD31/PECAM1|endoCAM|GPIIA'|PECA1|PECAM-1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 130kDa/110-135kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Uniprot:: P16284
Synonyme:: CD31;CD31 antigen;CD31/EndoCAM;endoCAM;GPIIA';PECA1;PECAM-1;platelet endothelial cell adhesion molecule;platelet endothelial cell adhesion molecule-1
Weitere Details:: The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.