PDGFR alpha Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2103
Zusätzliche Namen:: CD140A|PDGFR alpha|PDGFR-2|PDGFR2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 150-190kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTF
Uniprot:: P16234
Synonyme:: Alpha platelet-derived growth factor receptor;alpha-type platelet-derived growth factor receptor;CD140 antigen-like family member A;CD140A;CD140a antigen;PDGF-R-alpha;PDGFR-2;PDGFR2;Platelet-derived growth factor alpha receptor;platelet-derived growth factor receptor 2;platelet-derived growth factor receptor alpha;platelet-derived growth factor receptor, alpha polypeptide
Weitere Details:: This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies suggest that this gene plays a role in organ development, wound healing, and tumor progression. Mutations in this gene have been associated with idiopathic hypereosinophilic syndrome, somatic and familial gastrointestinal stromal tumors, and a variety of other cancers.

Versandbedingungen:: Blue Ice