PDE1B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2102
Zusätzliche Namen:: HEL-S-79p|PDE1B|PDE1B1|PDES1B
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 59kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Uniprot:: Q01064
Synonyme:: 63 kDa Cam-PDE;calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B;calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase;calmodulin-stimulated phosphodiesterase PDE1B1;cam-PDE 1B;epididymis secretory sperm binding protein Li 79p;HEL-S-79p;PDE1B1;PDES1B;phosphodiesterase 1B, calmodulin-dependent;presumed 63kDa form of the type 1 cyclic nucleotide phosphodiesterase family known as PDE1B
Weitere Details:: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Versandbedingungen:: Blue Ice