A20995
PGC1A Alpha Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A20995
- Zusätzliche Namen:
- LEM6|PGC-1(alpha)|PGC-1alpha|PGC-1v|PGC1|PGC1A|PGC1A Alpha|PPARGC1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QGNNSTKKGPEQSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQGQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
- Uniprot:
- Q9UBK2
- Synonyme:
- L-PGC-1alpha;LEM6;Ligand effect modulator 6;ligand effect modulator-6;peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext;peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a;peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT;peroxisome proliferator-activated receptor gamma coactivator 1-alpha;PGC-1-alpha;PGC-1(alpha);PGC-1alpha;PGC-1v;PGC1;PGC1A;PPAR gamma coactivator variant form;PPARgamma coactivator 1alpha;PPARGC-1-alpha;PPARGC1
- Weitere Details:
- The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.
- Versandbedingungen:
- Blue Ice




