[KO Validated] FTO Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20992
Zusätzliche Namen:: ALKBH9|BMIQ14|GDFD|TO
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: STGTLDYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK
Uniprot:: Q9C0B1
Synonyme:: AlkB homolog 9;ALKBH9;alpha-ketoglutarate-dependent dioxygenase FTO;BMIQ14;fat mass and obesity associated;fat mass and obesity-associated protein;GDFD;m6A(m)-demethylase FTO;mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO;mRNA N(6)-methyladenosine demethylase FTO;tRNA N1-methyl adenine demethylase FTO;U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO;U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO
Weitere Details:: This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes.

Versandbedingungen:: Blue Ice