A20979
PRPF31 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A20979
- Zusätzliche Namen:
- NY-BR-99|PRP31|PRPF31|RP11|SNRNP61
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTAS
- Uniprot:
- Q8WWY3
- Synonyme:
- hPrp31;NY-BR-99;Pre-mRNA-processing factor 31;protein 61K;PRP31;PRP31 pre-mRNA processing factor 31 homolog;RP11;serologically defined breast cancer antigen NY-BR-99;SNRNP61;U4/U6 small nuclear ribonucleoprotein Prp31;U4/U6 snRNP 61 kDa protein
- Weitere Details:
- This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs.
- Versandbedingungen:
- Blue Ice

