MMP9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2095
Zusätzliche Namen:: CLG4B|GELB|MANDP2|MMP-9|MMP9
Anwendung:: ELISA, WB
Molekulargewicht:: 84 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Uniprot:: P14780
Synonyme:: 92 kDa gelatinase;92 kDa type IV collagenase;CLG4B;Gelatinase B;GELB;macrophage gelatinase;MANDP2;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);matrix metalloproteinase-9;MMP-9;type V collagenase
Weitere Details:: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Versandbedingungen:: Blue Ice