GPRC5B Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20946
Zusätzliche Namen:: GPRC5B|RAIG-2|RAIG2
Anwendung:: ELISA, WB
Molekulargewicht:: 45 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
Uniprot:: Q9NZH0
Synonyme:: A-69G12.1;G protein-coupled receptor, family C, group 1, member B;G-protein coupled receptor family C group 5 member B;RAIG-2;RAIG2;retinoic acid responsive gene protein;retinoic acid-induced gene 2 protein
Weitere Details:: This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is associated with type 2 diabetes. Alternative splicing results in multiple transcript variants.