A20942
Pyrophosphatase 1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20942
- Zusätzliche Namen:
- HEL-S-66p|IOPPP|PP|PP1|Pyrophosphatase 1|SID6-8061
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT
- Uniprot:
- Q15181
- Synonyme:
- cytosolic inorganic pyrophosphatase;diphosphate phosphohydrolase;epididymis secretory sperm binding protein Li 66p;HEL-S-66p;inorganic diphosphatase 1;inorganic pyrophosphatase;IOPPP;PP;PP1;PPase;pyrophosphatase (inorganic) 1;pyrophosphatase 1;pyrophosphate phospho-hydrolase;SID6-8061
- Weitere Details:
- The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.
- Versandbedingungen:
- Blue Ice