Ki67 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2094
Zusätzliche Namen:: Ki67|KIA|MIB-|MIB-1|PPP1R105
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 359 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIKEQPQPSGKQESGSEIHVEVKAQSLVISPPAPSPRKTPVASDQRRRSCKTAPASSSKSQTEVPKRGGRKSGNLPSKRVSISRSQHDILQMICSKRRSGASEANLIVAKSWADVVKLGAKQTQTKVIKHG
Uniprot:: P46013
Synonyme:: antigen identified by monoclonal antibody Ki-67;antigen Ki67;KIA;MIB-;MIB-1;Molecular Immunology Borstel antibody 1;PPP1R105;proliferation marker protein Ki-67;proliferation-related Ki-67 antigen;protein phosphatase 1, regulatory subunit 105
Weitere Details:: Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.

Versandbedingungen:: Blue Ice